Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin protein P0 (MPZ), partial

This Recombinant Human Myelin protein P0 (MPZ), partial spans the amino acid sequence from region 30-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelin peripheral protein; MPP; Myelin protein zero

UniProt

P25189

Expression Region

30-156aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC 1 (S951) polyclonal antibody
orb642762-01 25 µL

SMC 1 (S951) polyclonal antibody

Sign In for Pricing
View Details
SMC 1 (S951) polyclonal antibody
orb642762-02 50 μL

SMC 1 (S951) polyclonal antibody

Sign In for Pricing
View Details
SMC 1 (S951) polyclonal antibody
orb642762-03 100 µL

SMC 1 (S951) polyclonal antibody

Sign In for Pricing
View Details
SMC 1 (S951) polyclonal antibody
orb642762-04 200 µL

SMC 1 (S951) polyclonal antibody

Sign In for Pricing
View Details
2-Methoxy-6-methylpyrimidine-4-yl-amine
BCA87075 10 g

2-Methoxy-6-methylpyrimidine-4-yl-amine

Sign In for Pricing
View Details
Human RHEBL1 (GTPase RhebL1) ELISA Kit
MBS7612237-01 48 Well

Human RHEBL1 (GTPase RhebL1) ELISA Kit

Sign In for Pricing
View Details