Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin transcription factor 1 (MYT1), partial

This Recombinant Human Myelin transcription factor 1 (MYT1), partial spans the amino acid sequence from region 900-1101aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MyT1; Myelin transcription factor I; MyTI; PLPB1; Proteolipid protein-binding protein

UniProt

Q01538

Expression Region

900-1101aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CPNE2 activation kit by CRISPRa
GA116599 1 Kit

Human CPNE2 activation kit by CRISPRa

Sign In for Pricing
View Details
MIR4448 Human qPCR Primer Pair (MI0016791)
HP300965 200 Reactions

MIR4448 Human qPCR Primer Pair (MI0016791)

Sign In for Pricing
View Details
Human CCDC37 (CFAP100) activation kit by CRISPRa
GA117688 1 Kit

Human CCDC37 (CFAP100) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS709706 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
PIAS1 Antibody
8C0361-AAT 50 µg

PIAS1 Antibody

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details