Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger and BTB domain-containing protein 10 (ZBTB10), partial

This Recombinant Human Zinc finger and BTB domain-containing protein 10 (ZBTB10), partial spans the amino acid sequence from region 713-779aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein RIN ZF

UniProt

Q96DT7

Expression Region

713-779aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GESSLIMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHVKRHSLVHKKDKKYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA4 (NM_001145263) Human Over-expression Lysate
LY428771 100 µg

NCOA4 (NM_001145263) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM72A (NM_001123168) Human Over-expression Lysate
LC426601 20 µg

FAM72A (NM_001123168) Human Over-expression Lysate

Sign In for Pricing
View Details
ccdc198 Mouse Gene Knockout Kit (CRISPR)
KN500078 1 Kit

ccdc198 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tide Quencher™ 8 CPG [TQ8 CPG] *500 Å*
2132-AAT 100 mg

Tide Quencher™ 8 CPG [TQ8 CPG] *500 Å*

Sign In for Pricing
View Details
4-Amino-2-ethoxy-5-nitro-N-4-piperidinyl-benzamide Hydrobromide
TRC-A608915-25MG 25 mg

4-Amino-2-ethoxy-5-nitro-N-4-piperidinyl-benzamide Hydrobromide

Sign In for Pricing
View Details
SVOP (NM_018711) Human Over-expression Lysate
LC402709 20 µg

SVOP (NM_018711) Human Over-expression Lysate

Sign In for Pricing
View Details