Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein beta/alpha (YWHAB)

This Recombinant Human 14-3-3 protein beta/alpha (YWHAB) spans the amino acid sequence from region 1-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein 1054Protein kinase C inhibitor protein 1 ; KCIP-1

UniProt

P31946

Expression Region

1-246aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Azido-L-phenylalanine Hydrochloride
TRC-A922600-25MG 25 mg

4-Azido-L-phenylalanine Hydrochloride

Sign In for Pricing
View Details
NME2 / nm23-H2 / NDPK-B (Suppressor of Metastasis) (CPTC-NME2-2), Biotin conjugate, 0.1mg/mL
BNCB2248-500 1x 500 µL

NME2 / nm23-H2 / NDPK-B (Suppressor of Metastasis) (CPTC-NME2-2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hieff Unicon™ Pro Universal TaqMan qPCR Mix(UDG Plus)
16710ES03 100 Tests

Hieff Unicon™ Pro Universal TaqMan qPCR Mix(UDG Plus)

Sign In for Pricing
View Details
HSP90AB1 Rabbit Polyclonal Antibody
AP02783PU-S 50 µL

HSP90AB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(3-Aminophenyl)ethanol
TRC-A615645-500MG 500 mg

2-(3-Aminophenyl)ethanol

Sign In for Pricing
View Details
SNF2H (SMARCA5) Rabbit Polyclonal Antibody
TA385280 100 µL

SNF2H (SMARCA5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details