Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein beta/alpha (YWHAB)

This Recombinant Human 14-3-3 protein beta/alpha (YWHAB) spans the amino acid sequence from region 1-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein 1054Protein kinase C inhibitor protein 1 ; KCIP-1

UniProt

P31946

Expression Region

1-246aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CRMP2 (Thr514) Rabbit Polyclonal Antibody (BF750)
orb2433039 100 µL

Phospho-CRMP2 (Thr514) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
14-3-3 gamma Antibody
DF7156-01 100 µL

14-3-3 gamma Antibody

Sign In for Pricing
View Details
14-3-3 gamma Antibody
DF7156-02 200 µL

14-3-3 gamma Antibody

Sign In for Pricing
View Details
Recombinant BKPyV Agnoprotein Protein, N-His-SUMO
AP97200 50 µg

Recombinant BKPyV Agnoprotein Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human ERP72 / PDIA4 Protein (Fc tag)
E53A06856 50 µg

Recombinant Human ERP72 / PDIA4 Protein (Fc tag)

Sign In for Pricing
View Details
Pomt2 (BC052045) Mouse Tagged Lenti ORF Clone
MR209338L4 10 µg

Pomt2 (BC052045) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details