Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2)

This Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2) spans the amino acid sequence from region 2-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich protein 2 ; CRP2LIM domain only protein 5 ; LMO-5Smooth muscle cell LIM protein ; SmLIM

UniProt

Q16527

Expression Region

2-193aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology; Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSWIM2 ORF Vector (Human) (pORF)
ORF012108 1.0 µg DNA

ZSWIM2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
NUP35 Rabbit pAb
A12762-01 20 µL

NUP35 Rabbit pAb

Sign In for Pricing
View Details
NUP35 Rabbit pAb
A12762-02 1000 μL

NUP35 Rabbit pAb

Sign In for Pricing
View Details
NUP35 Rabbit pAb
A12762-03 100 μL

NUP35 Rabbit pAb

Sign In for Pricing
View Details
NUP35 Rabbit pAb
A12762-04 500 μL

NUP35 Rabbit pAb

Sign In for Pricing
View Details
Alg9 (NM_133981) Mouse Untagged Clone
MC219600 10 µg

Alg9 (NM_133981) Mouse Untagged Clone

Sign In for Pricing
View Details