Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mucin 5, subtypes A and C, tracheobronchial/gastric (Muc5ac), partial

This Recombinant Mouse Mucin 5, subtypes A and C, tracheobronchial/gastric (Muc5ac), partial spans the amino acid sequence from region 2452-2721aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

E9PWB6

Expression Region

2452-2721aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVVSSSLCERCLCEVSSNPLSDVFMVSCETELCNTQCPKGSEYQAMPGQCCGKCIPKTCPFKNNSGSTYFYQPGELWAEPGNPCVTHKCEKFQDVLMVVTMKTECPKINCPQGQAQLREDGCCYDCPLPNQQKCTVHQRQQIIRQQNCSSEGPVSISYCQGNCGDSISMYSLEANKVEHTCECCQELQTSQRNVTLRCDDGSSQTFSYTQVEKCGCLGQQCHALGDTSHAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPNE9 Antibody Blocking peptide
orb1448607 500 µg

CPNE9 Antibody Blocking peptide

Sign In for Pricing
View Details
Mouse Lrfn1 Pre-designed siRNA Set B
SI107794B 1 Each

Mouse Lrfn1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
NOSTRIN (NM_052946) Human Over-expression Lysate
LS115677-20ug 20 µg

NOSTRIN (NM_052946) Human Over-expression Lysate

Sign In for Pricing
View Details
FLII Rabbit Polyclonal Antibody (APC)
orb1008431 100 µL

FLII Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
RFX1 (MHC Class II Regulatory Factor RFX1, Regulatory Factor X, 1 (Influences HLA Class II Expression)
490412 100 µL

RFX1 (MHC Class II Regulatory Factor RFX1, Regulatory Factor X, 1 (Influences HLA Class II Expression)

Sign In for Pricing
View Details
MCP-4 (h3) : 293T Lysate
sc-110922 100 µg - 200 µL

MCP-4 (h3) : 293T Lysate

Sign In for Pricing
View Details