Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Small proline-rich protein 2E (Sprr2e)

This Recombinant Mouse Small proline-rich protein 2E (Sprr2e) spans the amino acid sequence from region 1-76aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

O70556

Expression Region

1-76aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYQQQQCKQPCQPPPVCPPKKCPEPCPHPQCPEPCPPPKCPEPCPEPCPPPSYQQKCPPVQPPPPCQQKCPPKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Zyxin
E15233m 96 Tests

ELISA Kit For Zyxin

Sign In for Pricing
View Details
TM9SF4 Rabbit Polyclonal Antibody (HRP)
orb467702 100 µL

TM9SF4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lentiviral human TPM4 shRNA (UAS) - Lentiviral human TPM4 shRNA (UAS, GFP) (25)
GTR15128792 1 Vial

Lentiviral human TPM4 shRNA (UAS) - Lentiviral human TPM4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
IPO4
321021-01 50 µL

IPO4

Sign In for Pricing
View Details
IPO4
321021-02 100 µL

IPO4

Sign In for Pricing
View Details
Il-16 Antibody
R32904 100 µg

Il-16 Antibody

Sign In for Pricing
View Details