Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Lysozyme C, milk isozyme

This Recombinant Dog Lysozyme C, milk isozyme spans the amino acid sequence from region 1-129aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-beta-N-acetylmuramidase C

UniProt

P81708

Expression Region

1-129aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KIFSKCELARKLKSMGMDGFHGYSLANWVCMAEYESNFNTQAFNGRNSNGSSDYGIFQLNSKWWCKSNSHSSANACNIMCSKFLDDNIDDDIACAKRVVKDPNGMSAWVAWVKHCKGKDLSKYLASCNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: transverse
CR560450 5 µg

Tissue Total RNA, Colon: transverse

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), 0.2mg/mL
BNUB1372-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), 0.2mg/mL

Sign In for Pricing
View Details
CENPE Antibody
KC-43378-01 50 μL

CENPE Antibody

Sign In for Pricing
View Details
CENPE Antibody
KC-43378-02 100 µL

CENPE Antibody

Sign In for Pricing
View Details
CENPE Antibody
KC-43378-03 1 mL

CENPE Antibody

Sign In for Pricing
View Details
Neuroligin 4 (NLGN4X) (NM_001282145) Human Tagged ORF Clone
RG239621 10 µg

Neuroligin 4 (NLGN4X) (NM_001282145) Human Tagged ORF Clone

Sign In for Pricing
View Details