Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell migration-inducing and hyaluronan-binding protein (CEMIP), partial

This Recombinant Human Cell migration-inducing and hyaluronan-binding protein (CEMIP), partial spans the amino acid sequence from region 31-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8WUJ3

Expression Region

31-350aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVAAGCPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSATVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGLKYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sorcs1 activation kit by CRISPRa
GA206249 1 Kit

Mouse Sorcs1 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal IP6K1 Antibody [DyLight 650]
NBP3-00228C 0.1 mL

Rabbit Polyclonal IP6K1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Maltose binding protein Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61178R-BF750-01 20 µL

Maltose binding protein Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Maltose binding protein Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61178R-BF750-02 100 µL

Maltose binding protein Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
DDIT3 (4C4) Rabbit Monoclonal Antibody
E28M1157 100 µL

DDIT3 (4C4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mini Cooling Block
VS10ICB 1 Each

Mini Cooling Block

Sign In for Pricing
View Details