Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial

This Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial spans the amino acid sequence from region 24-317aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-12 receptor subunit beta-2; IL-12R subunit beta-2; IL-12R-beta-2; IL-12RB2

UniProt

Q99665

Expression Region

24-317aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF740 conjugate, 0.1mg/mL
BNC742067-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF5 (NM_001662) Human Over-expression Lysate
LY400628 100 µg

ARF5 (NM_001662) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn1r128 Mouse Gene Knockout Kit (CRISPR)
KN518930 1 Kit

Vmn1r128 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FXYD6 (NM_001164832) Human Over-expression Lysate
LY431748 100 µg

FXYD6 (NM_001164832) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human LGALS7 Protein (Sumo Tag)
PDEH100556-01 20 µg

Recombinant Human LGALS7 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human LGALS7 Protein (Sumo Tag)
PDEH100556-02 100 µg

Recombinant Human LGALS7 Protein (Sumo Tag)

Sign In for Pricing
View Details