Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6B Envelope glycoprotein H (gH), partial

This Recombinant Human herpesvirus 6B Envelope glycoprotein H (gH), partial spans the amino acid sequence from region 519-671aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GH

UniProt

P52543

Expression Region

519-671aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAAIQCLSPSEPAASLPLPNVTFVISPSYVIKGVSLTITTTIVATSIIITAIPLNSTCVSTNYKYAGQDLLVLRNISSQTCEFCQSVVMEYDDIDGPLQYIYIKNIDELKTLTDPNNNLLVPNTRTHYLLLAKNGSVFEMSEVGIDIDQVSII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]
TA503670BM 100 µL

SIRT6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF647 conjugate, 0.1mg/mL
BNC470823-500 1x 500 µL

P21 / WAF1 (CIP1/823), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808189 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
p53R2 (RRM2B) (NM_015713) Human Recombinant Protein
TP310340M 100 µg

p53R2 (RRM2B) (NM_015713) Human Recombinant Protein

Sign In for Pricing
View Details
TissueScan, Sarcoma cDNA Array I
HSRT301 5 Panels

TissueScan, Sarcoma cDNA Array I

Sign In for Pricing
View Details
CAMKK2 Human Gene Knockout Kit (CRISPR)
KN203468 1 Kit

CAMKK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details