Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6B Envelope glycoprotein H (gH), partial

This Recombinant Human herpesvirus 6B Envelope glycoprotein H (gH), partial spans the amino acid sequence from region 519-671aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GH

UniProt

P52543

Expression Region

519-671aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAAIQCLSPSEPAASLPLPNVTFVISPSYVIKGVSLTITTTIVATSIIITAIPLNSTCVSTNYKYAGQDLLVLRNISSQTCEFCQSVVMEYDDIDGPLQYIYIKNIDELKTLTDPNNNLLVPNTRTHYLLLAKNGSVFEMSEVGIDIDQVSII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 18 (Ab-33) Antibody
21306-01 50 µL

Keratin 18 (Ab-33) Antibody

Sign In for Pricing
View Details
Keratin 18 (Ab-33) Antibody
21306-02 100 µL

Keratin 18 (Ab-33) Antibody

Sign In for Pricing
View Details
OGT CRISPRa sgRNA lentivector (set of three targets)(Mouse)
32487124 3x 1.0µg DNA

OGT CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Recombinant Human KRT8/CK-8 Protein, N-His
bs-104675P-01 20 µg

Recombinant Human KRT8/CK-8 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KRT8/CK-8 Protein, N-His
bs-104675P-02 50 µg

Recombinant Human KRT8/CK-8 Protein, N-His

Sign In for Pricing
View Details
FASTKD5 Protein Vector (Mouse) (pPB-N-His)
PV178411 500 ng

FASTKD5 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details