Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial

This Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial spans the amino acid sequence from region 356-455aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTL-II

UniProt

Q9UIR0

Expression Region

356-455aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO)
243667 50 µL

AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO)

Sign In for Pricing
View Details
Human Dopachrome Tautomerase (DCT) ELISA Kit
RDR-DCT-Hu-96Tests 96 Tests

Human Dopachrome Tautomerase (DCT) ELISA Kit

Sign In for Pricing
View Details
NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (MaxLight 490)
249355-ML490 100 µL

NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (MaxLight 490)

Sign In for Pricing
View Details
CADM2 Rabbit pAb
E45R18611N-100 100 µL

CADM2 Rabbit pAb

Sign In for Pricing
View Details
Pamufetinib (TAS-115) 5mg
A21533-5 5 mg

Pamufetinib (TAS-115) 5mg

Sign In for Pricing
View Details
Lentiviral mouse Glrx3 shRNA (UAS) - Lentiviral mouseGlrx3 shRNA (UAS, GFP) (25)
GTR15186368 1 Vial

Lentiviral mouse Glrx3 shRNA (UAS) - Lentiviral mouseGlrx3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details