Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystatin-14 (Cst14)

This Recombinant Mouse Cystatin-14 (Cst14) spans the amino acid sequence from region 21-130aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin SC

UniProt

Q8VII3

Expression Region

21-130aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

INKEFLDVTKDLDYFVASVEFAVAQFNDNNPEENTYKLLEVGRAQKKTWTMIFLMDLEMGRTICKKHDENIHNCPLLQGSREKKVHCVFQVDARPWFSHFTILTSTCVPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THUMPD1P1 3'UTR Luciferase Stable Cell Line
TU025561 1.0 mL

THUMPD1P1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Carnitine O acetyltransferase/Carnitine acetylase (C/CAT1) ELISA Kit
GTR10367867 96 Well

Mouse Carnitine O acetyltransferase/Carnitine acetylase (C/CAT1) ELISA Kit

Sign In for Pricing
View Details
IDH3A Polyclonal Conjugated Antibody
C28664 100 µL

IDH3A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CD45R (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (PE-CY7) discontinued
C2400-27H1 100 Tests

CD45R (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (PE-CY7) discontinued

Sign In for Pricing
View Details
WAS 3'UTR Luciferase Stable Cell Line
TU028356 1.0 mL

WAS 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GPR3 Conjugated Antibody
C31211 100 µL

GPR3 Conjugated Antibody

Sign In for Pricing
View Details