Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystatin-14 (Cst14)

This Recombinant Mouse Cystatin-14 (Cst14) spans the amino acid sequence from region 21-130aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin SC

UniProt

Q8VII3

Expression Region

21-130aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

INKEFLDVTKDLDYFVASVEFAVAQFNDNNPEENTYKLLEVGRAQKKTWTMIFLMDLEMGRTICKKHDENIHNCPLLQGSREKKVHCVFQVDARPWFSHFTILTSTCVPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat N-chimaerin (CHN1) ELISA Kit
EIA06820Go 1 Kit

Goat N-chimaerin (CHN1) ELISA Kit

Sign In for Pricing
View Details
Human Monoclonal Fc gamma RI/CD64 Antibody (H22) [DyLight 488]
NBP2-81097G 0.1 mL

Human Monoclonal Fc gamma RI/CD64 Antibody (H22) [DyLight 488]

Sign In for Pricing
View Details
Human CNR2 Protein Lysate 20ug
IHUCNR2PLLY20UG 20 µg

Human CNR2 Protein Lysate 20ug

Sign In for Pricing
View Details
CD177 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0406008 1.0 µg DNA

CD177 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NDUFB1
CSB-CL015641HU2 10 μg Plasmid + 200 μL Glycerol

NDUFB1

Sign In for Pricing
View Details
C17orf75 Rabbit Polyclonal Antibody
orb556565 100 µL

C17orf75 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details