Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Double homeobox protein 4 (DUX4), partial

This Recombinant Human Double homeobox protein 4 (DUX4), partial spans the amino acid sequence from region 327-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Double homeobox protein 10

UniProt

Q9UBX2

Expression Region

327-424aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN5 Antibody, Biotin conjugated
CSB-PA025163LD01HU-01 50 µg

TSPAN5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TSPAN5 Antibody, Biotin conjugated
CSB-PA025163LD01HU-02 100 µg

TSPAN5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-human IFNa1 (Sifalimumab Biosimilar)
BIO0192SM-20mg 20 mg

Anti-human IFNa1 (Sifalimumab Biosimilar)

Sign In for Pricing
View Details
Canine Adrenomedullin (ADM) ELISA Kit
DL-ADM-c-01 48 Tests

Canine Adrenomedullin (ADM) ELISA Kit

Sign In for Pricing
View Details
Canine Adrenomedullin (ADM) ELISA Kit
DL-ADM-c-02 96 Tests

Canine Adrenomedullin (ADM) ELISA Kit

Sign In for Pricing
View Details
TREM2-IN-1
HY-160421-01 1 mg

TREM2-IN-1

Sign In for Pricing
View Details