Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tissue factor (F3), partial (Active)

This Recombinant Human Tissue factor (F3), partial (Active) spans the amino acid sequence from region 33-251aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P13726

Expression Region

33-251aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TF at 2 μg/mL can bind Anti-TF recombinant antibody. The EC50 is 1.434-1.635 ng/mL.

Form

Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ASGR1 protein
MBS1560993-01 0.05 mg

Recombinant Human ASGR1 protein

Sign In for Pricing
View Details
Recombinant Human ASGR1 protein
MBS1560993-02 0.1 mg

Recombinant Human ASGR1 protein

Sign In for Pricing
View Details
Recombinant Human ASGR1 protein
MBS1560993-03 5x 0.1 mg

Recombinant Human ASGR1 protein

Sign In for Pricing
View Details
Mouse Monoclonal Epsin-2 Antibody (OTI1G3) [HRP]
NBP2-71701H 0.1 mL

Mouse Monoclonal Epsin-2 Antibody (OTI1G3) [HRP]

Sign In for Pricing
View Details
Human Fibronectin (FN) ELISA Kit
MBS3801457-01 48 Well

Human Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Human Fibronectin (FN) ELISA Kit
MBS3801457-02 96 Well

Human Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details