Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2)

This Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2) spans the amino acid sequence from region 1-333aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bagpipe homeobox protein homolog 1; Homeobox protein NK-3 homolog B

UniProt

P97503

Expression Region

1-333aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM17 (TACE, TNF-alpha-converting Enzyme, Disintegrin and Metalloproteinase Domain-containing Protein 17, CD156b)
304750-01 50 µL

ADAM17 (TACE, TNF-alpha-converting Enzyme, Disintegrin and Metalloproteinase Domain-containing Protein 17, CD156b)

Sign In for Pricing
View Details
ADAM17 (TACE, TNF-alpha-converting Enzyme, Disintegrin and Metalloproteinase Domain-containing Protein 17, CD156b)
304750-02 100 µL

ADAM17 (TACE, TNF-alpha-converting Enzyme, Disintegrin and Metalloproteinase Domain-containing Protein 17, CD156b)

Sign In for Pricing
View Details
CIB2 (NM_001301224) Human Tagged ORF Clone
RC236458 10 µg

CIB2 (NM_001301224) Human Tagged ORF Clone

Sign In for Pricing
View Details
ENTPD1/CD39 Peptide
DF4031-BP 1 mg

ENTPD1/CD39 Peptide

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG (H&L) - AMCA
CSA2527-01 100 µL

Rabbit Anti-Mouse IgG (H&L) - AMCA

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG (H&L) - AMCA
CSA2527-02 500 μL

Rabbit Anti-Mouse IgG (H&L) - AMCA

Sign In for Pricing
View Details