Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial
This Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial spans the amino acid sequence from region 78-214aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD antigen CD314
UniProt
Q9GLF5
Expression Region
78-214aa
Tag
N-terminal mFc-tagged
Source
Mammalian cell
Origin
Sus scrofa (Pig)
Field of Research
Neuroscience; Immunology & Inflammation; Cell Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
17.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NLLFNQEAPSPLKESYCGPCPKNWICYRNSCYQFSNESKTWLQSQASCRSQNSSLLKIYSREDQDFFKLVKSYHWMGLVQIPTNRSWQWEDGSILSPNQITMVEMQNGSCAVYGSSFKGYTENCLTLNTYICMKRTV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6445611-01 0.1 mL
CFDP1 (p97, BCNT, CP27, SWC5, Yeti, CENP-29, BUCENTAUR, Craniofacial Development Protein 1) (PE)
Sign In for Pricing
View Details MBS6445611-02 5x 0.1 mL
CFDP1 (p97, BCNT, CP27, SWC5, Yeti, CENP-29, BUCENTAUR, Craniofacial Development Protein 1) (PE)
Sign In for Pricing
View Details 
abx313809-01 20 µg
Petite Integration Frequency 1 (PIF1) Antibody (HRP)
Sign In for Pricing
View Details abx313809-02 50 µg
Petite Integration Frequency 1 (PIF1) Antibody (HRP)
Sign In for Pricing
View Details abx313809-03 100 µg
Petite Integration Frequency 1 (PIF1) Antibody (HRP)
Sign In for Pricing
View Details abx313809-04 200 µg
Petite Integration Frequency 1 (PIF1) Antibody (HRP)
Sign In for Pricing
View Details