Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Matrix-remodeling-associated protein 7 (MXRA7), partial

This Recombinant Rat Matrix-remodeling-associated protein 7 (MXRA7), partial spans the amino acid sequence from region 28-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

F1M1U0

Expression Region

28-146aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRGAARAPESTTRAGDPGAPAPPEPPEPCALEPPSVGPCQFERLAEPEEEEPEAEGRQDEDSDSEMGPPTEEPEEEAGAAFSFKYSPGQLRGSQYKKMMTKEELEEEQRIELTSDLTSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPI-16552, PARG inhibitor
TBI1502-25MG 25 mg

GPI-16552, PARG inhibitor

Sign In for Pricing
View Details
NALP13 Antibody
25187 100 µL

NALP13 Antibody

Sign In for Pricing
View Details
TFRC Protein Lysate (Mouse) with C-HA Tag
46583034 100 µg

TFRC Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Benzyl 3- (hydroxymethyl) azetidine-1-carboxylate
HY-W058000 1 Each

Benzyl 3- (hydroxymethyl) azetidine-1-carboxylate

Sign In for Pricing
View Details
PEX19 Antibody
A40160-50UG 50 µg

PEX19 Antibody

Sign In for Pricing
View Details
Osteocalcin/BGLAP Rabbit Polyclonal Antibody (Fluoro488)
orb3075119 100 µg

Osteocalcin/BGLAP Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details