Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Matrix-remodeling-associated protein 7 (MXRA7), partial

This Recombinant Rat Matrix-remodeling-associated protein 7 (MXRA7), partial spans the amino acid sequence from region 28-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

F1M1U0

Expression Region

28-146aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRGAARAPESTTRAGDPGAPAPPEPPEPCALEPPSVGPCQFERLAEPEEEEPEAEGRQDEDSDSEMGPPTEEPEEEAGAAFSFKYSPGQLRGSQYKKMMTKEELEEEQRIELTSDLTSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RalA Recombinant Antibody, Biotin Conjugated
bsm-61044R-Biotin-01 20 µL

RalA Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
RalA Recombinant Antibody, Biotin Conjugated
bsm-61044R-Biotin-02 100 µL

RalA Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Cetirizine Impurity D
T40430-01 100 mg

Cetirizine Impurity D

Sign In for Pricing
View Details
Cetirizine Impurity D
T40430-02 500 mg

Cetirizine Impurity D

Sign In for Pricing
View Details
RPL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV714402 1.0 µg DNA

RPL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
BTK Capture Antibody
OAOA21905-100UG 100 µg

BTK Capture Antibody

Sign In for Pricing
View Details