Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Fibroblast growth factor 2 (FGF2)

This Recombinant Sheep Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 10-155aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

UniProt

P20003

Expression Region

10-155aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etonitazene-d5
TRC-E933602-5MG 5 mg

Etonitazene-d5

Sign In for Pricing
View Details
Usp22 Mouse Gene Knockout Kit (CRISPR)
KN518781 1 Kit

Usp22 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzyl 2-Acetamido-2-deoxy-Alpha-D-glucopyranoside
TRC-B212540-2.5G 2.5 g

Benzyl 2-Acetamido-2-deoxy-Alpha-D-glucopyranoside

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562049 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
TTLL9 (NM_001008409) Human Over-expression Lysate
LY423431 100 µg

TTLL9 (NM_001008409) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LZM (Lysozyme) ELISA Kit
E-EL-H1869-01 24 Tests

Human LZM (Lysozyme) ELISA Kit

Sign In for Pricing
View Details