Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C chemokine receptor type 5 (Ccr5), partial

This Recombinant Mouse C-C chemokine receptor type 5 (Ccr5), partial spans the amino acid sequence from region 263-354aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-C CKR-5; CC-CKR-5; CCR-5; MIP-1 alpha receptor

UniProt

P51682

Expression Region

263-354aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Toxoplasma gondii TaqMan Probe/Primer and Control Set
TM44710 100 Reactions

Toxoplasma gondii TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
SCN1B (NM_001037) Human Over-expression Lysate
LY422145 100 µg

SCN1B (NM_001037) Human Over-expression Lysate

Sign In for Pricing
View Details
NDRG3 Human Gene Knockout Kit (CRISPR)
KN417761 1 Kit

NDRG3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS712450 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
Tbcc Mouse Gene Knockout Kit (CRISPR)
KN517265 1 Kit

Tbcc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Propionaldehyde (>80%)
TRC-P782515-5G 5 g

Propionaldehyde (>80%)

Sign In for Pricing
View Details