Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human STEAP1 protein (STEAP1), partial

This Recombinant Human STEAP1 protein (STEAP1), partial spans the amino acid sequence from region 3-69aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Six-transmembrane epithelial antigen of prostate 1

UniProt

Q9UHE8

Expression Region

3-69aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (Fc gamma RIII alpha, NK cells)
C2267-30L 200 µg

CD16 (Fc gamma RIII alpha, NK cells)

Sign In for Pricing
View Details
Trifluoperazine
C11410-1g 1 g

Trifluoperazine

Sign In for Pricing
View Details
VPC-70063
BA3269-25 25 mg

VPC-70063

Sign In for Pricing
View Details
Telomeric G4s ligand 1
orb3134355-01 50 mg

Telomeric G4s ligand 1

Sign In for Pricing
View Details
Telomeric G4s ligand 1
orb3134355-02 10 mg

Telomeric G4s ligand 1

Sign In for Pricing
View Details
NaBC1 (B-12) HRP
sc-393808 HRP 200 µg/mL

NaBC1 (B-12) HRP

Sign In for Pricing
View Details