Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Formin-2 (FMN2), partial

This Recombinant Human Formin-2 (FMN2), partial spans the amino acid sequence from region 1284-1673aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9NZ56

Expression Region

1284-1673aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KQPIEPCRPMKPLYWTRIQLHSKRDSSTSLIWEKIEEPSIDCHEFEELFSKTAVKERKKPISDTISKTKAKQVVKLLSNKRSQAVGILMSSLHLDMKDIQHAVVNLDNSVVDLETLQALYENRAQSDELEKIEKHGRSSKDKENAKSLDKPEQFLYELSLIPNFSERVFCILFQSTFSESICSIRRKLELLQKLCETLKNGPGVMQVLGLVLAFGNYMNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCLFPLPEPQDLFQASQMKFEDFQKDLRKLKKDLKACEVEAGKVYQVSSKEHMQPFKENMEQFIIQAKIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF405S conjugate, 0.1mg/mL
BNC040940-500 1x 500 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CHD1 Human Gene Knockout Kit (CRISPR)
KN421575 1 Kit

CHD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Nitrosopiperidine-d4
TRC-N545373-1MG 1 mg

N-Nitrosopiperidine-d4

Sign In for Pricing
View Details
Omeprazole Sulfone
TRC-O635025-5MG 5 mg

Omeprazole Sulfone

Sign In for Pricing
View Details
Human MEST activation kit by CRISPRa
GA102882 1 Kit

Human MEST activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS806244 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details