Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 2 (BRD2), partial

This Recombinant Human Bromodomain-containing protein 2 (BRD2), partial spans the amino acid sequence from region 65-187aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Really interesting new gene 3 protein

UniProt

P25440

Expression Region

65-187aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THOC1 (E-10) PE
sc-514123 PE 200 µg/mL

THOC1 (E-10) PE

Sign In for Pricing
View Details
PAF Polyclonal Antibody, Cy7 Conjugated
bs-1119R-Cy7 100 µL

PAF Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
AKR1B1 Antibody
CSB-PA263919-01 50 μL

AKR1B1 Antibody

Sign In for Pricing
View Details
AKR1B1 Antibody
CSB-PA263919-02 100 µL

AKR1B1 Antibody

Sign In for Pricing
View Details
Sheep Phosphodiesterase ELISA kit
GTR10458106 96 Well

Sheep Phosphodiesterase ELISA kit

Sign In for Pricing
View Details
AS3MT Protein Vector (Mouse) (pPM-C-HA)
12492024 500 ng

AS3MT Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details