Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Transposon Tn3 resolvase (tnpR)

This Recombinant Escherichia coli Transposon Tn3 resolvase (tnpR) spans the amino acid sequence from region 1-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0ADI2

Expression Region

1-185aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRIFGYARVSTSQQSLDIQIRALKDAGVKANRIFTDKASGSSTDREGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVAVRFIDDGISTDGDMGQMVVTILSAVAQAERRRILERTNEGRQEAKLKGIKFGRRRTVDRNVVLTLHQKGTGATEIAHQLSIARSTVYKILEDERAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS27 Antibody
OAAJ05054-100UL 100 µL

MRPS27 Antibody

Sign In for Pricing
View Details
Human Glutaredoxin 3/GLRX3 MAb (Clone 791431)
MAB7560-SP 25 µg

Human Glutaredoxin 3/GLRX3 MAb (Clone 791431)

Sign In for Pricing
View Details
IFluor® 594 Anti-human CD11b Antibody *HI11b*
101110C0-AAT 100 Tests

IFluor® 594 Anti-human CD11b Antibody *HI11b*

Sign In for Pricing
View Details
HELT (NM_001300782) Human Untagged Clone
SC334756 10 µg

HELT (NM_001300782) Human Untagged Clone

Sign In for Pricing
View Details
Rat Cross linked C-telopeptide of type I collagen (CTX-I) ELISA Kit
AE62849RA-01 48 Tests

Rat Cross linked C-telopeptide of type I collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details
Rat Cross linked C-telopeptide of type I collagen (CTX-I) ELISA Kit
AE62849RA-02 96 Tests

Rat Cross linked C-telopeptide of type I collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details