Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial

This Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial spans the amino acid sequence from region 320-487aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EBNA-2; EBV nuclear antigen 2

UniProt

P12978

Expression Region

320-487aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPPWWPPICDPPQPSKTQGQSRGQSRGRGRGRGRGRGKGKSRDKQRKPGGPWRPEPNTSSPSMPELSPVLGLHQGQGAGDSPTPGPSNAAPVCRNSHTATPNVSPIHEPESHNSPEAPILFPDDWYPPSIDPADLDESWDYIFETTESPSSDEDYVEGPSKRPRPSIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED7 Rabbit Polyclonal Antibody (Biotin)
orb2129038 100 µL

MED7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Catenin, beta (p120)
MBS439900-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Catenin, beta (p120)

Sign In for Pricing
View Details
Catenin, beta (p120)
MBS439900-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Catenin, beta (p120)

Sign In for Pricing
View Details
Catenin, beta (p120)
MBS439900-03 0.1 mg (Without BSA at 1mg/mL)

Catenin, beta (p120)

Sign In for Pricing
View Details
Catenin, beta (p120)
MBS439900-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Catenin, beta (p120)

Sign In for Pricing
View Details
Catenin, beta (p120)
MBS439900-05 5x 0.1 mg (Without BSA at 1mg/mL)

Catenin, beta (p120)

Sign In for Pricing
View Details