Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukemia inhibitory factor (Lif)

This Recombinant Mouse Leukemia inhibitory factor (Lif) spans the amino acid sequence from region 24-203aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LIF; Differentiation-stimulating factor (D factor)

UniProt

P09056

Expression Region

24-203aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIL6 CRISPR Activation Plasmid (h)
sc-415440-ACT 20 µg

PPIL6 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Guinea pig mannan binding lectin associated serine protease (MASP) ELISA Kit
NSL0061Gp 96 Tests

Guinea pig mannan binding lectin associated serine protease (MASP) ELISA Kit

Sign In for Pricing
View Details
Sperm Ab1
A05-Ab1 Each

Sperm Ab1

Sign In for Pricing
View Details
(2,5-difluorophenyl) (4-fluorophenyl) methanone
PC1015335-01 250 mg

(2,5-difluorophenyl) (4-fluorophenyl) methanone

Sign In for Pricing
View Details
(2,5-difluorophenyl) (4-fluorophenyl) methanone
PC1015335-02 500 mg

(2,5-difluorophenyl) (4-fluorophenyl) methanone

Sign In for Pricing
View Details
(2,5-difluorophenyl) (4-fluorophenyl) methanone
PC1015335-03 1 g

(2,5-difluorophenyl) (4-fluorophenyl) methanone

Sign In for Pricing
View Details