Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukemia inhibitory factor (Lif)

This Recombinant Mouse Leukemia inhibitory factor (Lif) spans the amino acid sequence from region 24-203aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LIF; Differentiation-stimulating factor (D factor)

UniProt

P09056

Expression Region

24-203aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RBM18 Antibody
NBP2-31670 0.1 mL

Rabbit Polyclonal RBM18 Antibody

Sign In for Pricing
View Details
KPNA5 Protein Vector (Human) (pPM-C-His)
PV023088 500 ng

KPNA5 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
4- (isobutylthio) -3-nitrobenzoic acid
sc-348347A 5 g

4- (isobutylthio) -3-nitrobenzoic acid

Sign In for Pricing
View Details
PKNOX1 (PBX/knotted 1 Homeobox 1, Pbx Regulating Protein-1, Human Homeobox-containing Protein, PREP1, Pkonx1c) (PE)
207844-PE 100 µL

PKNOX1 (PBX/knotted 1 Homeobox 1, Pbx Regulating Protein-1, Human Homeobox-containing Protein, PREP1, Pkonx1c) (PE)

Sign In for Pricing
View Details
RN5S130 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV743566 1.0 µg DNA

RN5S130 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) PPNP Polyclonal Antibody
MBS7150893 Inquire

Rabbit anti-Escherichia coli (strain K12) PPNP Polyclonal Antibody

Sign In for Pricing
View Details