Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8

This Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 spans the amino acid sequence from region 2-111aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LZ-8

UniProt

P14945

Expression Region

2-111aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Ganoderma lucidum (Ling zhi medicinal fungus) (Bracket fungus)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Serine/threonine protein kinase ULK3 (ULK3) ELISA kit
GTR10414512 96 Well

Porcine Serine/threonine protein kinase ULK3 (ULK3) ELISA kit

Sign In for Pricing
View Details
FOXK1 Antibody - middle region : HRP (ARP47522_P050-HRP)
ARP47522_P050-HRP 100 µL

FOXK1 Antibody - middle region : HRP (ARP47522_P050-HRP)

Sign In for Pricing
View Details
H-Gly-Arg-Gly-Asp-Asn-Pro-OH
H-3174.0005 5.0mg

H-Gly-Arg-Gly-Asp-Asn-Pro-OH

Sign In for Pricing
View Details
Label Sheets, Cryo,43x19mm, for Cryovials
LCS-43X19G 1040/Box

Label Sheets, Cryo,43x19mm, for Cryovials

Sign In for Pricing
View Details
Dbp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3644908 1.0 µg DNA

Dbp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human MyoD family inhibitor domain-containing protein (MDFIC) ELISA Kit
abx532549 96 Tests

Human MyoD family inhibitor domain-containing protein (MDFIC) ELISA Kit

Sign In for Pricing
View Details