Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8

This Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 spans the amino acid sequence from region 2-111aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LZ-8

UniProt

P14945

Expression Region

2-111aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Ganoderma lucidum (Ling zhi medicinal fungus) (Bracket fungus)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PAU7 Polyclonal Antibody
MBS7157494 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PAU7 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF827 CytoSection
TS421405P5 25 Slides

ZNF827 CytoSection

Sign In for Pricing
View Details
SODD (Silencer of Death Domains, BCL2-associated Athanogene 4, BAG4) discontinued
S2000-32 50 µg

SODD (Silencer of Death Domains, BCL2-associated Athanogene 4, BAG4) discontinued

Sign In for Pricing
View Details
Reagecon Sodium Hydroxide 30% w/w (40% w/v) Low in Nitrogen Kjeldahl Reagent
S30WWLN 5 L

Reagecon Sodium Hydroxide 30% w/w (40% w/v) Low in Nitrogen Kjeldahl Reagent

Sign In for Pricing
View Details
Mouse Rbfox1 / RNA binding protein fox-1 homolog 1 Recombinant Protein
R15320m 1 Each

Mouse Rbfox1 / RNA binding protein fox-1 homolog 1 Recombinant Protein

Sign In for Pricing
View Details
LNPEP 3'UTR Luciferase Stable Cell Line
TU012546 1.0 mL

LNPEP 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details