Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Immediate-early protein 1 (U90/U89), partial

This Recombinant Human herpesvirus 6A Immediate-early protein 1 (U90/U89), partial spans the amino acid sequence from region 665-941aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IE1; Protein RF2/RF3/RF4; pRF2/pRF3/pRF4

UniProt

Q69567

Expression Region

665-941aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSESDSESSSESNDCTSEHKQLHLSDYDEVTNNGHCPSYGFPTPVFTIPIRSMQGTGGIKSKFIPKKNWIWYMKKTHQVDNCPIHNSENVDAKDDSDGTEAKHCFMNHFVPIKTDDEDYDKNNVSYIYNKIQNSKIDSGDIIPTKKLIIDMVMDNFMDLNDIIKQGITKHCQDLCNKYNVVTPTTCEDDLNMTNSQTFATTATQVFDPPVTGNNSSILNIINDTTSQNDENRCTEGTSNSNEKCTNISDCNSDGTEAFKLDGYPSDYDPFVENAQIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)
MBS2146441-01 0.1 mL

Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)
MBS2146441-02 0.2 mL

Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)
MBS2146441-03 0.5 mL

Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)
MBS2146441-04 1 mL

Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)
MBS2146441-05 5 mL

Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)
MBS2146441-06 5x 5 mL

Cy3-Linked Monoclonal Antibody to 11-Hydroxyprogesterone (11-OHP)

Sign In for Pricing
View Details