Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)

This Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2) spans the amino acid sequence from region 20-89aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Verocytotoxin 2 subunit B ; Verotoxin 2 subunit B

UniProt

P09386

Expression Region

20-89aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Escherichia phage 933W (Bacteriophage 933W)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cluster of Differentiation 40 Ligand / TNFSF5 (CD40LG) Antibody
abx146726 100 µg

Cluster of Differentiation 40 Ligand / TNFSF5 (CD40LG) Antibody

Sign In for Pricing
View Details
RalA Binding Protein 1 Rabbit Monoclonal Antibody [KD Validation]
E51K62445 40 µL

RalA Binding Protein 1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Goat Polyclonal VGLUT1 Antibody
NBP1-52551 0.05 mg

Goat Polyclonal VGLUT1 Antibody

Sign In for Pricing
View Details
GCS1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-13322R-PE-Cy7 100 µL

GCS1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal HABP1/C1QBP/GC1q R Antibody (106)
NBP2-90476-50ul 50 µL

Rabbit Monoclonal HABP1/C1QBP/GC1q R Antibody (106)

Sign In for Pricing
View Details
Porcine Anti-Foot and Mouth Disease Virus Type Asia-I IgG (FMDV-Asia I IgG) ELISA Kit
SLY0291Po-01 96 Tests

Porcine Anti-Foot and Mouth Disease Virus Type Asia-I IgG (FMDV-Asia I IgG) ELISA Kit

Sign In for Pricing
View Details