Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Beta-nerve growth factor (Ngf)

This Recombinant Rat Beta-nerve growth factor (Ngf) spans the amino acid sequence from region 19-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-NGF

UniProt

P25427

Expression Region

19-241aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPAEPIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTQPPPTSSDTLDLDFQAHGTISFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanine nucleotide-binding protein G(q) subunit alpha Antibody
MBS7157396 Inquire

Guanine nucleotide-binding protein G(q) subunit alpha Antibody

Sign In for Pricing
View Details
CDC28 Antibody
orb843976 2 mg

CDC28 Antibody

Sign In for Pricing
View Details
OSBPL9 (NM_148908) Human Tagged Lenti ORF Clone
RC221053L3 10 µg

OSBPL9 (NM_148908) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Sp100 Nuclear Antigen (Sp100)
MBS2091865-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Sp100 Nuclear Antigen (Sp100)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Sp100 Nuclear Antigen (Sp100)
MBS2091865-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Sp100 Nuclear Antigen (Sp100)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Sp100 Nuclear Antigen (Sp100)
MBS2091865-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Sp100 Nuclear Antigen (Sp100)

Sign In for Pricing
View Details