Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Astrotactin-1 (ASTN1), partial

This Recombinant Human Astrotactin-1 (ASTN1), partial spans the amino acid sequence from region 22-153aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O14525

Expression Region

22-153aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELRILH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Mouse Vanin 3 (VNN3) ELISA
KLM6487 1x 96 Well

GENLISA™ Mouse Vanin 3 (VNN3) ELISA

Sign In for Pricing
View Details
ADAM12-OT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV718253 1.0 µg DNA

ADAM12-OT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
HSPA8 Antibody
CSB-PA002973-01 50 µg

HSPA8 Antibody

Sign In for Pricing
View Details
HSPA8 Antibody
CSB-PA002973-02 100 µg

HSPA8 Antibody

Sign In for Pricing
View Details
Anti-CD20 (ripertamab biosimilar) mAb
12-90296-100 100 µg

Anti-CD20 (ripertamab biosimilar) mAb

Sign In for Pricing
View Details
Taq DNA Polymerase (Buffer without Mgcl2)
BPC1039-1 500 U

Taq DNA Polymerase (Buffer without Mgcl2)

Sign In for Pricing
View Details