Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cysteine-rich protein 1 (CRIP1), partial

This Recombinant Human Cysteine-rich protein 1 (CRIP1) spans the amino acid sequence from region 2-77aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich heart protein

UniProt

P50238

Expression Region

2-77aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-ACTN1 (aa596-609) Antibody
dAP-3115 50 µg

Goat anti-ACTN1 (aa596-609) Antibody

Sign In for Pricing
View Details
Olfr1208 sgRNA CRISPR Lentivector set (Mouse)
K4281401 3x 1.0 µg

Olfr1208 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
DDRGK1 Human Over-expression Lysate
orb1371019 20 µg

DDRGK1 Human Over-expression Lysate

Sign In for Pricing
View Details
Clonidine hydrochloride
C6060-01 1 g

Clonidine hydrochloride

Sign In for Pricing
View Details
Clonidine hydrochloride
C6060-02 5 g

Clonidine hydrochloride

Sign In for Pricing
View Details
Clonidine hydrochloride
C6060-03 25 g

Clonidine hydrochloride

Sign In for Pricing
View Details