Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C1orf54 homolog

This Recombinant Mouse Uncharacterized protein C1orf54 homolog spans the amino acid sequence from region 17-148aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein L259

UniProt

Q8R2K8

Expression Region

17-148aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEYDHEEQLEEGDYYQVAYYYYTVTPNYDDFSVNFTVDYSVFESEDRLNRLNKEVTTTEAVETTASSYSLHTELMDPQNPVTTKPVTTEPVTTEPVTTEPQSPNQNDAMSTLQSPVSCFLLWTLLQGGVHFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/3226), CF647 conjugate, 0.1mg/mL
BNC473226-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GSTA1 Antibody
A24042-50UG 50 µg

GSTA1 Antibody

Sign In for Pricing
View Details
Anti Abarelix Pab Rat
150022-01 100 mL

Anti Abarelix Pab Rat

Sign In for Pricing
View Details
Anti Abarelix Pab Rat
150022-02 100 µg

Anti Abarelix Pab Rat

Sign In for Pricing
View Details
Mouse Monoclonal Non-species specific IgG2a Isotype Control (IGG2a/6723) [mFluor Violet 500 SE]
NBP3-27042MFV500 0.1 mL

Mouse Monoclonal Non-species specific IgG2a Isotype Control (IGG2a/6723) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
SLC2A4 ELISA Kit (Mouse) (OKCD07917)
OKCD07917 96 Well

SLC2A4 ELISA Kit (Mouse) (OKCD07917)

Sign In for Pricing
View Details