Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dipeptidase 2 (DPEP2)

This Recombinant Human Dipeptidase 2 (DPEP2) spans the amino acid sequence from region 33-463aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9H4A9

Expression Region

33-463aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Liquid or Lyophilized powder

AA Sequence

AYTTPGPPRALTTLGAPRAHTMPGTYAPSTTLSSPSTQGLQEQARALMRDFPLVDGHNDLPLVLRQVYQKGLQDVNLRNFSYGQTSLDRLRDGLVGAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERGIC And Golgi 3 (ERGIC3) Antibody
abx034282-01 80 µL

ERGIC And Golgi 3 (ERGIC3) Antibody

Sign In for Pricing
View Details
ERGIC And Golgi 3 (ERGIC3) Antibody
abx034282-02 400 µL

ERGIC And Golgi 3 (ERGIC3) Antibody

Sign In for Pricing
View Details
Ly-6G Antibody [G12L5]
C15416-100uL 100 µL

Ly-6G Antibody [G12L5]

Sign In for Pricing
View Details
Lentiviral mouse Rhpn1 shRNA (UAS) - Lentiviral mouse Rhpn1 shRNA (UAS, iRFP) (100)
GTR15301518 1 Vial

Lentiviral mouse Rhpn1 shRNA (UAS) - Lentiviral mouse Rhpn1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
MRE-269
orb1223120-01 200 mg

MRE-269

Sign In for Pricing
View Details
MRE-269
orb1223120-02 500 mg

MRE-269

Sign In for Pricing
View Details