Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dendroaspis Natriuretic Peptide

Dendroaspis Natriuretic Peptide is a vasodilator peptide that can be isolated from animal venom.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

4190.72

Notes

For research use only.

AA Sequence

EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA (Disulfide bridge: Cys7-Cys23)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GPRASP1 Antibody [DyLight 488]
NBP3-06130G 0.1 mL

Rabbit Polyclonal GPRASP1 Antibody [DyLight 488]

Sign In for Pricing
View Details
Chicken Doublecortin Like Kinase 1 (DCLK1) ELISA Kit
abx355764 96 Well

Chicken Doublecortin Like Kinase 1 (DCLK1) ELISA Kit

Sign In for Pricing
View Details
Recombinant CAMK2B Antibody
RC-4148-01 50 μL

Recombinant CAMK2B Antibody

Sign In for Pricing
View Details
Recombinant CAMK2B Antibody
RC-4148-02 100 µL

Recombinant CAMK2B Antibody

Sign In for Pricing
View Details
Recombinant CAMK2B Antibody
RC-4148-03 1 mL

Recombinant CAMK2B Antibody

Sign In for Pricing
View Details
1-Boc-2,6-Dimethyl-4-oxopiperidine
FB167775-01 1 g

1-Boc-2,6-Dimethyl-4-oxopiperidine

Sign In for Pricing
View Details