Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Unconventional myosin-XVI (MYO16), partial

This Recombinant Human Unconventional myosin-XVI (MYO16), partial spans the amino acid sequence from region 1303-1453aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3; Unconventional myosin-16

UniProt

Q9Y6X6

Expression Region

1303-1453aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPNTRLSASYEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAPGAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gallopamil hydrochloride
M26224-01 1 g

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
M26224-02 5 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
M26224-03 10 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
M26224-04 25 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
M26224-05 50 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
M26224-06 100 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details