Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adipocyte plasma membrane-associated protein (APMAP), partial

This Recombinant Human Adipocyte plasma membrane-associated protein (APMAP), partial spans the amino acid sequence from region 62-416aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein BSCv

UniProt

Q9HDC9

Expression Region

62-416aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Filamin Binding LIM Protein 1 (FBLIM1) ELISA Kit
BSKH66063-01 48 Tests

Human Filamin Binding LIM Protein 1 (FBLIM1) ELISA Kit

Sign In for Pricing
View Details
Human Filamin Binding LIM Protein 1 (FBLIM1) ELISA Kit
BSKH66063-02 96 Tests

Human Filamin Binding LIM Protein 1 (FBLIM1) ELISA Kit

Sign In for Pricing
View Details
Human TUBB6 Protein Lysate
MBS8429332-01 0.02 mg

Human TUBB6 Protein Lysate

Sign In for Pricing
View Details
Human TUBB6 Protein Lysate
MBS8429332-02 5x 0.02 mg

Human TUBB6 Protein Lysate

Sign In for Pricing
View Details
TIMP3 Rabbit Polyclonal Antibody
orb584248 100 µL

TIMP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RRAGB Antibody
MBS9605847-01 0.1 mL

RRAGB Antibody

Sign In for Pricing
View Details