Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 4 (BRD4), partial

This Recombinant Human Bromodomain-containing protein 4 (BRD4), partial spans the amino acid sequence from region 342-460aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HUNK1

UniProt

O60885

Expression Region

342-460aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep AMP deaminase 2 (AMPD2) ELISA kit
GTR10416553 96 Well

Sheep AMP deaminase 2 (AMPD2) ELISA kit

Sign In for Pricing
View Details
ViaCheck™ Viability Control 90% (VC40B-20)
24625-20 20 mL

ViaCheck™ Viability Control 90% (VC40B-20)

Sign In for Pricing
View Details
Agrin Rabbit pAb
E2160842 100 µL

Agrin Rabbit pAb

Sign In for Pricing
View Details
RPS24, ID (RPS24, 40S ribosomal protein S24) (MaxLight 650) discontinued
041242-ML650 100 µL

RPS24, ID (RPS24, 40S ribosomal protein S24) (MaxLight 650) discontinued

Sign In for Pricing
View Details
HAND2, CT (Heart and Neural Crest Derivatives Expressed 2, Heart- and Neural Crest Derivatives-expressed Protein 2, Class A Basic Helix-loop-helix Protein 26, bHLHa26, Deciduum Heart Autonomic Nervous System and Neural Crest Derivatives-expressed Protein 2, DHAND2, dHAND, FLJ16260, Hed, MGC125303, MGC125304, Thing2)
H1779-70C 200 µL

HAND2, CT (Heart and Neural Crest Derivatives Expressed 2, Heart- and Neural Crest Derivatives-expressed Protein 2, Class A Basic Helix-loop-helix Protein 26, bHLHa26, Deciduum Heart Autonomic Nervous System and Neural Crest Derivatives-expressed Protein 2, DHAND2, dHAND, FLJ16260, Hed, MGC125303, MGC125304, Thing2)

Sign In for Pricing
View Details
SPARC-like protein 1 SPARCL1/SPARC Rabbit Polyclonal Antibody (Fluoro594)
orb3080617 100 µg

SPARC-like protein 1 SPARCL1/SPARC Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details