Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Autophagy-related protein 2 homolog A (ATG2A), partial

This Recombinant Human Autophagy-related protein 2 homolog A (ATG2A), partial spans the amino acid sequence from region 1-527aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q2TAZ0

Expression Region

1-527aa

Tag

N-terminal 6xHis-tagged and C-terminal Strep II-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRWLWPWSNCVKERVCRYLLHHYLGHFFQEHLSLDQLSLDLYKGSVALRDIHLEIWSVNEVLESMESPLELVEGFVGSIEVAVPWAALLTDHCTVRVSGLQLTLQPRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMFAQTIETVLRRIKVTFLDTVVRVEHSPGDGERGVAVEVRVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLAGVRLHYEELPAQEEPPEPPLQIGSCSGYMELMVKLKQNEAFPGPKLEVAGQLGSLHLLLTPRQLQQLQELLSAVSLTDHEGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKMTLGGVTLTLLQTSAPSSGPPDLATHFFTEFDATKDGPFGSRDFHHLRPRFQRACPCSHVRLTGTAVQLSWELRTGSRGRRTTSMEVHFGQLEVLECLW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2AC7 (NM_021065) Human Recombinant Protein
TP762519 50 µg

H2AC7 (NM_021065) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Atp6v0e activation kit by CRISPRa
GA200336 1 Kit

Mouse Atp6v0e activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant LILRB1 Antibody
RC-5781-01 50 μL

Recombinant LILRB1 Antibody

Sign In for Pricing
View Details
Recombinant LILRB1 Antibody
RC-5781-02 100 µL

Recombinant LILRB1 Antibody

Sign In for Pricing
View Details
Recombinant LILRB1 Antibody
RC-5781-03 1 mL

Recombinant LILRB1 Antibody

Sign In for Pricing
View Details
MyGel Mini Electrophoresis System Starter Kit (Includes E1101-E, A1701 and W4000-100)
E1101-SK-E 1 Each

MyGel Mini Electrophoresis System Starter Kit (Includes E1101-E, A1701 and W4000-100)

Sign In for Pricing
View Details