Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-25/IL-17E, Rat (HEK293, Fc)

IL-25/IL-17E is a member of the IL-17 family. IL-25/IL-17E Protein, Rat (HEK293, Fc) is the recombinant rat-derived IL-25/IL-17E protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

IL-25/IL-17E Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-25-il-17e-protein-rat-hek293-fc.html

Purity

98.0

Smiles

VSLRIQEDCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA

Molecular Formula

501996 (Gene_ID) D3ZLB1 (V17-A169) (Accession)

Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-500 1x 500 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-100 1x 100 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3 + CA72/733), CF568 conjugate, 0.1mg/mL
BNC680734-100 1x 100 µL

TAG-72 / CA72.4 (B72.3 + CA72/733), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details