UBE2Z, Human (His)
UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
UBE2Z Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ube2z-protein-human-his.html
Smiles
MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Molecular Formula
65264 (Gene_ID) Q9H832-2 (M1-V246) (Accession)
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDMH100165-01 20 µg
Recombinant Human Cathepsin B Protein (His Tag)
Sign In for Pricing
View Details PDMH100165-02 100 µg
Recombinant Human Cathepsin B Protein (His Tag)
Sign In for Pricing
View Details PDMH100165-03 500 µg
Recombinant Human Cathepsin B Protein (His Tag)
Sign In for Pricing
View Details