Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2Z, Human (His)

UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2Z Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2z-protein-human-his.html

Smiles

MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV

Molecular Formula

65264 (Gene_ID) Q9H832-2 (M1-V246) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Rectum
CS712628 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
Rnase2a (NM_053113) Mouse Tagged ORF Clone
MG201155 10 µg

Rnase2a (NM_053113) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human CSGALNACT1 activation kit by CRISPRa
GA110972 1 Kit

Human CSGALNACT1 activation kit by CRISPRa

Sign In for Pricing
View Details
AHSG Antibody
KC-1849-01 50 μL

AHSG Antibody

Sign In for Pricing
View Details
AHSG Antibody
KC-1849-02 100 µL

AHSG Antibody

Sign In for Pricing
View Details
AHSG Antibody
KC-1849-03 1 mL

AHSG Antibody

Sign In for Pricing
View Details