Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-SARS-CoV-2 ORF8 Antibody, Dylight550 Conjugate

Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog # A33995. Tested in ELISA applications. This antibody reacts with Human.

Product Specifications

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.

Synonyms

ORF8 protein; ORF8; Non-structural protein 8; ns8

Gene Name

ORF8 protein

Gene ID

43740577

UniProt

P0DTC8

Host

Rabbit

Reactivity

Human

Immunogen

AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Clonality

Polyclonal

Tissue Specificity

Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .

Applications

ELISA

Purification

Immunogen affinity purified.

Concentration

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Form

Lyophilized

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Function

Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.

Components

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

References & Citations

1. Gordon DE, et al. Nature, 2020 Jul. 2. Gordon DE, et al. Science, 2020 Oct 15. 3. Li JY, et al. Virus Res, 2020 Sep. 4. Wu F, et al. Nature, 2020 Mar.

Storage Conditions

Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.

Calculated Molecular Weight

16693 MW

Observed Molecular Weight

140 kDa, 130 kDa, 110 kDa

Fragment

Rabbit IgG

Applications Notes

ELISA, 0.001-0.1μg/ml, Human

Subcellular Location

Cytoplasm .

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mptx1 (NM_025470) Mouse Tagged Lenti ORF Clone
MR219765L3 10 µg

Mptx1 (NM_025470) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rgs7bp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3744506 1.0 µg DNA

Rgs7bp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
EXOC6B Protein Vector (Human) (pPB-C-His)
PV076325 500 ng

EXOC6B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Proteasome subunit beta type 4 Antibody (OTI2C9) [Alexa Fluor 488]
NBP2-73655AF488 0.1 mL

Mouse Monoclonal Proteasome subunit beta type 4 Antibody (OTI2C9) [Alexa Fluor 488]

Sign In for Pricing
View Details
Wdr17 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4202503 1.0 µg DNA

Wdr17 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Protein Phosphatase 2A (PP2A) (MaxLight 490) discontinued
P9107-33F-ML490 100 µL

Protein Phosphatase 2A (PP2A) (MaxLight 490) discontinued

Sign In for Pricing
View Details