Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Lysozyme C (LYZ) (E53A)

Product Specifications

CAS Number

9000-83-3

Gene Name

LYZ

UniProt

P00698

Expression Region

19-147aa (E53A)

Organism

Gallus gallus

Target Sequence

KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFASNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL

Tag

Tag-Free

Source

E.coli

Field of Research

Cardiovascular

Assay Type

In Stock Protein

Relevance

Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.4 kDa

References & Citations

"Molecular characterization of goose- and chicken-type lysozymes in emu (Dromaius novaehollandiae): evidence for extremely low lysozyme levels in emu egg white." Maehashi K., Matano M., Irisawa T., Uchino M., Kashiwagi Y., Watanabe T. Gene 492:244-249 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) AO1 Polyclonal Antibody
MBS7145711 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) AO1 Polyclonal Antibody

Sign In for Pricing
View Details
IL-1ra/IL-1F3/IL1RN Overexpression Lysate (Native) - (Dry Ice)
NBL1-11933 0.1 mg

IL-1ra/IL-1F3/IL1RN Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Lentiviral human MC4R sgRNA gene knockout kit - Lentiviral human MC4R sgRNA gene knockout kit (25)
GTR15382068 1 Vial

Lentiviral human MC4R sgRNA gene knockout kit - Lentiviral human MC4R sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rabbit Polyclonal PCCB Antibody
NBP1-85887 0.1 mL

Rabbit Polyclonal PCCB Antibody

Sign In for Pricing
View Details
ASB7 Rabbit pAb
E45R23198N-100 100 µL

ASB7 Rabbit pAb

Sign In for Pricing
View Details
Prolactin, Antibody
GWB-8DB949 1 mL

Prolactin, Antibody

Sign In for Pricing
View Details